PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pavir.3KG099600.4.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
Family GRAS
Protein Properties Length: 630aa    MW: 71741.5 Da    PI: 7.1855
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pavir.3KG099600.4.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS371.98.1e-1142516212374
                 GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPil 91 
                          +  L++cA+a++ ++l  a +lL++++++asp+gd+ qRla+yf+++L+arla+++ ++y++l  ++t+    ++ l+a++lf+ ++P+ 
  Pavir.3KG099600.4.p 251 RAFLIQCAQAIAVNNLPFAGELLKKIRQHASPYGDSSQRLAHYFANGLEARLAGTGFKMYQKLMEKRTR---AIDMLKAYRLFVAACPFA 337
                          678*********************************************************999999998...9***************** PP

                 GRAS  92 kfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpfefn 179
                          ++++   Nq+I + ++++ +vHiiDf+i+ G+QWp+L++ +a+R++gpp+lRiTg+g p++g   + ++ +tg+rLa++Ae ++vpf+++
  Pavir.3KG099600.4.p 338 RVAYYFSNQTIADVLNRQPKVHIIDFGITIGFQWPSLIKRFAKREGGPPKLRITGIGVPHPGfrPSAMIDATGKRLAEYAEMFHVPFQYQ 427
                          ************************************************************99999************************* PP

                 GRAS 180 vlvakrledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfd 269
                            +a+r+e++ +e+L+++++E+l+Vn+++q ++l de+ +++s+rd+vL+++k+++P+v+++   + ++ns+ Fl rf e l +ys+lfd
  Pavir.3KG099600.4.p 428 G-IASRWENICTEDLNIDKDEVLIVNCMYQTKYLGDETEDIDSARDRVLRIMKKINPEVFILGIINGSYNSPFFLPRFREVLFHYSSLFD 516
                          *.7*************************************************************************************** PP

                 GRAS 270 sleaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslv 359
                          ++++ +++++e+ri +Er llg ++ nvvacegaer+er et+++W++r  +aGFk++p+++ + k      +k + d + ++e++g+l+
  Pavir.3KG099600.4.p 517 MYNTIVAQNDEARILIERDLLGTDVLNVVACEGAERIERPETYKQWQARSLKAGFKQLPVNQAILKRSIDEKKKNYHDDFVINEDNGWLL 606
                          ****************************************************************998877777777788*********** PP

                 GRAS 360 lgWkdrpLvsvSaWr 374
                          +gWk+r +++vS+W+
  Pavir.3KG099600.4.p 607 QGWKGRIMYAVSSWK 621
                          **************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098564.522224601IPR005202Transcription factor GRAS
PfamPF035142.8E-111251621IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 630 aa     Download sequence    Send to blast
MESPEYCEIN SNMTLDYINR LLMENTDEKA SIYQQHDALQ ATEKPFYDIL GQAYPSSPKE  60
TMIRTNSHID CLQDSSNSYT EWAGSGSFAS DILGPQGMQL VANDWASERD RLSSQFQRGA  120
EEANKLVPSI EKLLVDLDSN VLSGYNQMIG AATGQKIKHA SKIQNHPHAD LELLEARNGK  180
HLAISASETI RDETFDSVLL CDWEVHSDAA YLREMKVKEA SNSQQNVQSK EYGQGQVKSR  240
GKKKEQWIDL RAFLIQCAQA IAVNNLPFAG ELLKKIRQHA SPYGDSSQRL AHYFANGLEA  300
RLAGTGFKMY QKLMEKRTRA IDMLKAYRLF VAACPFARVA YYFSNQTIAD VLNRQPKVHI  360
IDFGITIGFQ WPSLIKRFAK REGGPPKLRI TGIGVPHPGF RPSAMIDATG KRLAEYAEMF  420
HVPFQYQGIA SRWENICTED LNIDKDEVLI VNCMYQTKYL GDETEDIDSA RDRVLRIMKK  480
INPEVFILGI INGSYNSPFF LPRFREVLFH YSSLFDMYNT IVAQNDEARI LIERDLLGTD  540
VLNVVACEGA ERIERPETYK QWQARSLKAG FKQLPVNQAI LKRSIDEKKK NYHDDFVINE  600
DNGWLLQGWK GRIMYAVSSW KPKEQYSNK*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A7e-522546218375GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008648647.10.0PREDICTED: scarecrow-like protein 9
TrEMBLA0A096RDF20.0A0A096RDF2_MAIZE; Uncharacterized protein
STRINGGRMZM2G089636_P010.0(Zea mays)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G37650.11e-169GRAS family protein